SIGLEC15 Recombinant Protein, Human

Artikelnummer: ASB-OPCA03192
Artikelname: SIGLEC15 Recombinant Protein, Human
Artikelnummer: ASB-OPCA03192
Hersteller Artikelnummer: OPCA03192
Alternativnummer: ASB-OPCA03192-20UG,ASB-OPCA03192-100UG,ASB-OPCA03192-1MG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: CD33 antigen-like 3,CD33 molecule-like 3,CD33L3,HsT1361,sialic acid-binding Ig-like lectin 15,SIGLEC-15.
Binds sialylated glycoproteins.
Molekulargewicht: 42.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 284266
UniProt: Q6ZMC9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST