SIGLEC15 Recombinant Protein, Human

Catalog Number: ASB-OPCA03192
Article Name: SIGLEC15 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA03192
Supplier Catalog Number: OPCA03192
Alternative Catalog Number: ASB-OPCA03192-20UG,ASB-OPCA03192-100UG,ASB-OPCA03192-1MG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: CD33 antigen-like 3,CD33 molecule-like 3,CD33L3,HsT1361,sialic acid-binding Ig-like lectin 15,SIGLEC-15.
Binds sialylated glycoproteins.
Molecular Weight: 42.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 284266
UniProt: Q6ZMC9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST