UL111A Recombinant Protein, Virus

Artikelnummer: ASB-OPCA03200
Artikelname: UL111A Recombinant Protein, Virus
Artikelnummer: ASB-OPCA03200
Hersteller Artikelnummer: OPCA03200
Alternativnummer: ASB-OPCA03200-20UG,ASB-OPCA03200-100UG,ASB-OPCA03200-1MG
Hersteller: Aviva
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Alternative Synonym: cmvIL-10 vIL-10
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.
Molekulargewicht: 34 kda
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P17150
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK