UL111A Recombinant Protein, Virus

Catalog Number: ASB-OPCA03200
Article Name: UL111A Recombinant Protein, Virus
Biozol Catalog Number: ASB-OPCA03200
Supplier Catalog Number: OPCA03200
Alternative Catalog Number: ASB-OPCA03200-20UG,ASB-OPCA03200-100UG,ASB-OPCA03200-1MG
Manufacturer: Aviva
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Virus
Alternative Names: cmvIL-10 vIL-10
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.
Molecular Weight: 34 kda
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P17150
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK