Toxin MIT1 Recombinant Protein

Artikelnummer: ASB-OPCA03204
Artikelname: Toxin MIT1 Recombinant Protein
Artikelnummer: ASB-OPCA03204
Hersteller Artikelnummer: OPCA03204
Alternativnummer: ASB-OPCA03204-20UG,ASB-OPCA03204-100UG,ASB-OPCA03204-1MG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Alternative Synonym: Black mamba intestinal toxin 1,Black mamba venom protein A.
Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2 (PubMed:12054613). Potently contracts gastrointestinal (GI) smooth muscle (PubMed:10567694).
Molekulargewicht: 24.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P25687
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS