Toxin MIT1 Recombinant Protein

Catalog Number: ASB-OPCA03204
Article Name: Toxin MIT1 Recombinant Protein
Biozol Catalog Number: ASB-OPCA03204
Supplier Catalog Number: OPCA03204
Alternative Catalog Number: ASB-OPCA03204-20UG,ASB-OPCA03204-100UG,ASB-OPCA03204-1MG
Manufacturer: Aviva
Category: Proteine/Peptide
Alternative Names: Black mamba intestinal toxin 1,Black mamba venom protein A.
Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2 (PubMed:12054613). Potently contracts gastrointestinal (GI) smooth muscle (PubMed:10567694).
Molecular Weight: 24.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P25687
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS