Trem2 Recombinant Protein, Mouse

Artikelnummer: ASB-OPCA03208
Artikelname: Trem2 Recombinant Protein, Mouse
Artikelnummer: ASB-OPCA03208
Hersteller Artikelnummer: OPCA03208
Alternativnummer: ASB-OPCA03208-20UG,ASB-OPCA03208-100UG,ASB-OPCA03208-1MG
Hersteller: Aviva
Wirt: Mouse
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Alternative Synonym: Trem,TREM-2,Trem2a,Trem2b,Trem2c,triggering receptor expressed on monocytes 2,triggering receptor expressed on myeloid cells 2,triggering receptor expressed on myeloid cells 2a,triggering receptor expressed on myeloid cells 2b,triggering receptor expressed on myeloid cells 2c.
Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.
Molekulargewicht: 20.8 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 83433
UniProt: Q99NH8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS