Trem2 Recombinant Protein, Mouse

Catalog Number: ASB-OPCA03208
Article Name: Trem2 Recombinant Protein, Mouse
Biozol Catalog Number: ASB-OPCA03208
Supplier Catalog Number: OPCA03208
Alternative Catalog Number: ASB-OPCA03208-20UG,ASB-OPCA03208-100UG,ASB-OPCA03208-1MG
Manufacturer: Aviva
Host: Mouse
Category: Proteine/Peptide
Species Reactivity: Mouse
Alternative Names: Trem,TREM-2,Trem2a,Trem2b,Trem2c,triggering receptor expressed on monocytes 2,triggering receptor expressed on myeloid cells 2,triggering receptor expressed on myeloid cells 2a,triggering receptor expressed on myeloid cells 2b,triggering receptor expressed on myeloid cells 2c.
Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.
Molecular Weight: 20.8 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 83433
UniProt: Q99NH8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS