Pepsin inhibitor 3 Recombinant Protein, Parasite

Artikelnummer: ASB-OPCA03219
Artikelname: Pepsin inhibitor 3 Recombinant Protein, Parasite
Artikelnummer: ASB-OPCA03219
Hersteller Artikelnummer: OPCA03219
Alternativnummer: ASB-OPCA03219-20UG,ASB-OPCA03219-100UG,ASB-OPCA03219-1MG
Hersteller: Aviva
Wirt: Parasite
Kategorie: Proteine/Peptide
Spezies Reaktivität: Parasite
Alternative Synonym: PI-3
This is an inhibitor of the aspartic protease pepsin.
Molekulargewicht: 32.4 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P19400
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ