Pepsin inhibitor 3 Recombinant Protein, Parasite

Catalog Number: ASB-OPCA03219
Article Name: Pepsin inhibitor 3 Recombinant Protein, Parasite
Biozol Catalog Number: ASB-OPCA03219
Supplier Catalog Number: OPCA03219
Alternative Catalog Number: ASB-OPCA03219-20UG,ASB-OPCA03219-100UG,ASB-OPCA03219-1MG
Manufacturer: Aviva
Host: Parasite
Category: Proteine/Peptide
Species Reactivity: Parasite
Alternative Names: PI-3
This is an inhibitor of the aspartic protease pepsin.
Molecular Weight: 32.4 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P19400
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ