Anpep Recombinant Protein, Rat

Artikelnummer: ASB-OPCA03221
Artikelname: Anpep Recombinant Protein, Rat
Artikelnummer: ASB-OPCA03221
Hersteller Artikelnummer: OPCA03221
Alternativnummer: ASB-OPCA03221-20UG,ASB-OPCA03221-100UG,ASB-OPCA03221-1MG
Hersteller: Aviva
Wirt: Rat
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Alternative Synonym: alanyl (membrane) aminopeptidase,Alanyl aminopeptidase,aminopeptidase M,aminopeptidase N,Apm,AP-M,Apn,AP-N,cluster of differentiation antigen 13 (CD13),kidney aminopeptidase M,kidney Zn peptidase,KZP,Lap1,leucine arylaminopeptidase 1,membrane alanine aminopeptidase,microsomal aminopeptidase,rAPN.
Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization.
Molekulargewicht: 65.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 81641
UniProt: P15684
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YAQEKNRNAENSAIAPTLPGSTSATTSTTNPAIDESKPWNQYRLPKTLIPDSYQVTLRPYLTPNEQGLYIFKGSSTVRFTCNETTNVIIIHSKKLNYTNKGNHRVALRALGDTPAPNIDTTELVERTEYLVVHLQGSLVKGHQYEMDSEFQGELADDLAGFYRSEYMEGGNKKVVATTQMQAADARKSFPCFDEPAMKASFNITLIHPNNLTALSNMLPKDSRTLQEDPSWNVTEFHPTPKMSTYLLAYIVSEFK