Anpep Recombinant Protein, Rat

Catalog Number: ASB-OPCA03221
Article Name: Anpep Recombinant Protein, Rat
Biozol Catalog Number: ASB-OPCA03221
Supplier Catalog Number: OPCA03221
Alternative Catalog Number: ASB-OPCA03221-20UG,ASB-OPCA03221-100UG,ASB-OPCA03221-1MG
Manufacturer: Aviva
Host: Rat
Category: Proteine/Peptide
Species Reactivity: Rat
Alternative Names: alanyl (membrane) aminopeptidase,Alanyl aminopeptidase,aminopeptidase M,aminopeptidase N,Apm,AP-M,Apn,AP-N,cluster of differentiation antigen 13 (CD13),kidney aminopeptidase M,kidney Zn peptidase,KZP,Lap1,leucine arylaminopeptidase 1,membrane alanine aminopeptidase,microsomal aminopeptidase,rAPN.
Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization.
Molecular Weight: 65.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 81641
UniProt: P15684
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YAQEKNRNAENSAIAPTLPGSTSATTSTTNPAIDESKPWNQYRLPKTLIPDSYQVTLRPYLTPNEQGLYIFKGSSTVRFTCNETTNVIIIHSKKLNYTNKGNHRVALRALGDTPAPNIDTTELVERTEYLVVHLQGSLVKGHQYEMDSEFQGELADDLAGFYRSEYMEGGNKKVVATTQMQAADARKSFPCFDEPAMKASFNITLIHPNNLTALSNMLPKDSRTLQEDPSWNVTEFHPTPKMSTYLLAYIVSEFK