FANC Recombinant Protein (Escherichia coli)

Artikelnummer: ASB-OPCA03790
Artikelname: FANC Recombinant Protein (Escherichia coli)
Artikelnummer: ASB-OPCA03790
Hersteller Artikelnummer: OPCA03790
Alternativnummer: ASB-OPCA03790-100UG, ASB-OPCA03790-1MG, ASB-OPCA03790-20UG
Hersteller: Aviva
Kategorie: Antikörper
Spezies Reaktivität: E. coli
Immunogen: 23-181aa
Alternative Synonym: fanCK99 fimbrial protein
Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.
Konzentration: Varies by lot. See vial for exact concentration.
Molekulargewicht: 32.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM