FANC Recombinant Protein (Escherichia coli)

Catalog Number: ASB-OPCA03790
Article Name: FANC Recombinant Protein (Escherichia coli)
Biozol Catalog Number: ASB-OPCA03790
Supplier Catalog Number: OPCA03790
Alternative Catalog Number: ASB-OPCA03790-100UG, ASB-OPCA03790-1MG, ASB-OPCA03790-20UG
Manufacturer: Aviva
Category: Antikörper
Species Reactivity: E. coli
Immunogen: 23-181aa
Alternative Names: fanCK99 fimbrial protein
Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.
Concentration: Varies by lot. See vial for exact concentration.
Molecular Weight: 32.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM