PPP1R1B Recombinant Protein (Human)

Artikelnummer: ASB-OPCA04790
Artikelname: PPP1R1B Recombinant Protein (Human)
Artikelnummer: ASB-OPCA04790
Hersteller Artikelnummer: OPCA04790
Alternativnummer: ASB-OPCA04790-100UG, ASB-OPCA04790-1MG, ASB-OPCA04790-20UG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: DARPP32,DARPP-32,Dopamine- and cAMP-regulated neuronal phosphoprotein,dopamine and cAMP-regulated neuronal phosphoprotein 32,protein phosphatase 1 regulatory subunit 1B.
Inhibitor of protein-phosphatase 1.
Molekulargewicht: 45.7 kDa
Tag: N-terminal GST-tagged
NCBI: 84152
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT