PPP1R1B Recombinant Protein (Human)

Catalog Number: ASB-OPCA04790
Article Name: PPP1R1B Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04790
Supplier Catalog Number: OPCA04790
Alternative Catalog Number: ASB-OPCA04790-100UG, ASB-OPCA04790-1MG, ASB-OPCA04790-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: DARPP32,DARPP-32,Dopamine- and cAMP-regulated neuronal phosphoprotein,dopamine and cAMP-regulated neuronal phosphoprotein 32,protein phosphatase 1 regulatory subunit 1B.
Inhibitor of protein-phosphatase 1.
Molecular Weight: 45.7 kDa
Tag: N-terminal GST-tagged
NCBI: 84152
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT