SOCS2 Recombinant Protein (Human)

Artikelnummer: ASB-OPCA04795
Artikelname: SOCS2 Recombinant Protein (Human)
Artikelnummer: ASB-OPCA04795
Hersteller Artikelnummer: OPCA04795
Alternativnummer: ASB-OPCA04795-100UG, ASB-OPCA04795-1MG, ASB-OPCA04795-20UG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: CIS2,CIS-2,Cish2,cytokine-inducible SH2 protein 2,SOCS-2,SSI2,SSI-2,STATI2,STAT-induced STAT inhibitor 2,suppressor of cytokine signaling 2.
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Molekulargewicht: 49.2 kDa
Tag: N-terminal GST-tagged
NCBI: 8835
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV