SOCS2 Recombinant Protein (Human)

Catalog Number: ASB-OPCA04795
Article Name: SOCS2 Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04795
Supplier Catalog Number: OPCA04795
Alternative Catalog Number: ASB-OPCA04795-100UG, ASB-OPCA04795-1MG, ASB-OPCA04795-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: CIS2,CIS-2,Cish2,cytokine-inducible SH2 protein 2,SOCS-2,SSI2,SSI-2,STATI2,STAT-induced STAT inhibitor 2,suppressor of cytokine signaling 2.
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Molecular Weight: 49.2 kDa
Tag: N-terminal GST-tagged
NCBI: 8835
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV