SPAG16 Recombinant Protein (Human)

Artikelnummer: ASB-OPCA04796
Artikelname: SPAG16 Recombinant Protein (Human)
Artikelnummer: ASB-OPCA04796
Hersteller Artikelnummer: OPCA04796
Alternativnummer: ASB-OPCA04796-100UG, ASB-OPCA04796-1MG, ASB-OPCA04796-20UG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: PF20,pf20 protein homolog,sperm-associated antigen 16 protein,sperm-associated WD repeat protein,WD repeat domain 29,WDR29.
Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia (By similarity).
Molekulargewicht: 47.6 kDa
Tag: N-terminal GST-tagged
NCBI: 79582
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF