SPAG16 Recombinant Protein (Human)

Catalog Number: ASB-OPCA04796
Article Name: SPAG16 Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04796
Supplier Catalog Number: OPCA04796
Alternative Catalog Number: ASB-OPCA04796-100UG, ASB-OPCA04796-1MG, ASB-OPCA04796-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: PF20,pf20 protein homolog,sperm-associated antigen 16 protein,sperm-associated WD repeat protein,WD repeat domain 29,WDR29.
Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia (By similarity).
Molecular Weight: 47.6 kDa
Tag: N-terminal GST-tagged
NCBI: 79582
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF