VENTX Recombinant Protein (Human)

Produktübersicht

• Artikelname: VENTX Recombinant Protein (Human)
• Artikelnummer: ASB-OPCA04804
• Hersteller Artikelnummer: OPCA04804
• Alternativnummer: ASB-OPCA04804-100UG, ASB-OPCA04804-1MG, ASB-OPCA04804-20UG
• Hersteller: Aviva
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: hemopoietic progenitor homeobox protein VENTX2,homeobox protein VENTX,HPX42B,NA88A,VENT homeobox homolog,VENT-like homeobox 2,VENT-like homeobox protein 2,VENTX2.

Produktbeschreibung

May be involved in ventralization.

Produkteigenschaften

• Molekulargewicht: 54.6 kDa
• Tag: N-terminal GST-tagged
• NCBI: 27287
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTG