VENTX Recombinant Protein (Human)

Product Overview

• Article Name: VENTX Recombinant Protein (Human)
• Biozol Catalog Number: ASB-OPCA04804
• Supplier Catalog Number: OPCA04804
• Alternative Catalog Number: ASB-OPCA04804-100UG, ASB-OPCA04804-1MG, ASB-OPCA04804-20UG
• Manufacturer: Aviva
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: hemopoietic progenitor homeobox protein VENTX2,homeobox protein VENTX,HPX42B,NA88A,VENT homeobox homolog,VENT-like homeobox 2,VENT-like homeobox protein 2,VENTX2.

Product Description

May be involved in ventralization.

Product Properties

• Molecular Weight: 54.6 kDa
• Tag: N-terminal GST-tagged
• NCBI: 27287
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTG