WISP2 Recombinant Protein (Human)

Artikelnummer: ASB-OPCA04805
Artikelname: WISP2 Recombinant Protein (Human)
Artikelnummer: ASB-OPCA04805
Hersteller Artikelnummer: OPCA04805
Alternativnummer: ASB-OPCA04805-100UG, ASB-OPCA04805-1MG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: CCN family member 5,connective tissue growth factor-like protein,connective tissue growth factor-related protein 58,CT58,CTGF-L,WISP2,WNT1 inducible signaling pathway protein 2.
May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Molekulargewicht: 51.3 kDa
Tag: N-terminal GST-tagged
NCBI: 8839
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF