WISP2 Recombinant Protein (Human)

Catalog Number: ASB-OPCA04805
Article Name: WISP2 Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04805
Supplier Catalog Number: OPCA04805
Alternative Catalog Number: ASB-OPCA04805-100UG, ASB-OPCA04805-1MG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: CCN family member 5,connective tissue growth factor-like protein,connective tissue growth factor-related protein 58,CT58,CTGF-L,WISP2,WNT1 inducible signaling pathway protein 2.
May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Molecular Weight: 51.3 kDa
Tag: N-terminal GST-tagged
NCBI: 8839
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF