IL 1 beta Protein, E. coli

Artikelnummer: ASB-OPPA00739
Artikelname: IL 1 beta Protein, E. coli
Artikelnummer: ASB-OPPA00739
Hersteller Artikelnummer: OPPA00739
Alternativnummer: ASB-OPPA00739-5UG
Hersteller: Aviva
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: IL-1, IL1F2, IL1beta, IL1-BETA
Interleukin-1b is a potent pro-inflammatory cytokine produced by a wide variety of cell types including monocytes and macrophages. It displays a broad range of biological activity including activation of B and T cells in response to inflammation and the activation of endothelial cells.
Konzentration: 1 mg/ml
Molekulargewicht: 22 kDa
Tag: amino-terminal hexahistidine tag
NCBI: 3553
Reinheit: Greater than 95.0% as determined by analysis by SDS-PAGE.
Formulierung: Liquid 20mM Tris-HCl (pH 8.0) and 50% glycerol
Sequenz: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS