IL 1 beta Protein, E. coli

Catalog Number: ASB-OPPA00739
Article Name: IL 1 beta Protein, E. coli
Biozol Catalog Number: ASB-OPPA00739
Supplier Catalog Number: OPPA00739
Alternative Catalog Number: ASB-OPPA00739-5UG
Manufacturer: Aviva
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: IL-1, IL1F2, IL1beta, IL1-BETA
Interleukin-1b is a potent pro-inflammatory cytokine produced by a wide variety of cell types including monocytes and macrophages. It displays a broad range of biological activity including activation of B and T cells in response to inflammation and the activation of endothelial cells.
Concentration: 1 mg/ml
Molecular Weight: 22 kDa
Tag: amino-terminal hexahistidine tag
NCBI: 3553
Purity: Greater than 95.0% as determined by analysis by SDS-PAGE.
Form: Liquid 20mM Tris-HCl (pH 8.0) and 50% glycerol
Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS