HPV 16 Protein, E. coli

Produktübersicht

• Artikelname: HPV 16 Protein, E. coli
• Artikelnummer: ASB-OPPA02429
• Hersteller Artikelnummer: OPPA02429
• Alternativnummer: ASB-OPPA02429-100UG
• Hersteller: Aviva
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Alternative Synonym: Papillomavirus, HPV, Papilloma Virus, HPV 16, HPV16

Produktbeschreibung

The Recombinant HPV-16 antigen is a full length protein expressed in E. coli having an Mw of 56.7kDa. The protein is fused to a 26kDa GST-Tag, having a total Mw of 82.7kDA and purified by standard chromatography.

Produkteigenschaften

• Reinheit: Greater than >95% pure as determined by 12% SDS-PAGE (Coomassie staining).
• Formulierung: Recombinant HPV-16 (0.6mg/ml) solution in Phosphate buffer, 50mM arginine and 0.02% sodium azide. Physical appearance: Sterile filtered clear liquid formulation.
• Sequenz: MQVTFIYILVITCYENDVNVYHIFFQMSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFGAMDFTTLQANKSEVPLDICTSIC