HPV 16 Protein, E. coli

Product Overview

• Article Name: HPV 16 Protein, E. coli
• Biozol Catalog Number: ASB-OPPA02429
• Supplier Catalog Number: OPPA02429
• Alternative Catalog Number: ASB-OPPA02429-100UG
• Manufacturer: Aviva
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Virus
• Alternative Names: Papillomavirus, HPV, Papilloma Virus, HPV 16, HPV16

Product Description

The Recombinant HPV-16 antigen is a full length protein expressed in E. coli having an Mw of 56.7kDa. The protein is fused to a 26kDa GST-Tag, having a total Mw of 82.7kDA and purified by standard chromatography.

Product Properties

• Purity: Greater than >95% pure as determined by 12% SDS-PAGE (Coomassie staining).
• Form: Recombinant HPV-16 (0.6mg/ml) solution in Phosphate buffer, 50mM arginine and 0.02% sodium azide. Physical appearance: Sterile filtered clear liquid formulation.
• Sequence: MQVTFIYILVITCYENDVNVYHIFFQMSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFGAMDFTTLQANKSEVPLDICTSIC