Human DEFENSIN BETA 2 Protein

Artikelnummer: ASB-OPSA11014
Artikelname: Human DEFENSIN BETA 2 Protein
Artikelnummer: ASB-OPSA11014
Hersteller Artikelnummer: OPSA11014
Alternativnummer: ASB-OPSA11014-20UG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: BD-2, SAP1, DEFB2, DEFB4, HBD-2, DEFB-2, DEFB102
RECOMBINANT HUMAN DEFENSIN BETA 2
Defensin beta-2 (BD-2), is a member of the beta defensin family, secreted at epithelial surfaces of the skin and respiratory tract and by some leukocytes. BD-2 is induced by bacterial products and cytokines during inflammation and functions as part of the innate immune system, having a wide ranging antimicrobial activity. BD-2 also functions as a chemoattractant to immature dendritic cells and memory T cells and acts as a ligand for TLR4, upregulating co-stimulatory molecules and inducing dendritic cell maturation.
Konzentration: 0.1 mg/ml
Molekulargewicht: 4.3 kDa (41 amino acid sequence/residues)
NCBI: 1673
Reinheit: >98% by SDS PAGE and HPLC analysis.
Formulierung: Lyophilized
Sequenz: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP