Human DEFENSIN BETA 2 Protein
Catalog Number:
ASB-OPSA11014
- Images (0)
| Article Name: | Human DEFENSIN BETA 2 Protein |
| Biozol Catalog Number: | ASB-OPSA11014 |
| Supplier Catalog Number: | OPSA11014 |
| Alternative Catalog Number: | ASB-OPSA11014-20UG |
| Manufacturer: | Aviva |
| Category: | Proteine/Peptide |
| Application: | ELISA, FA, WB |
| Species Reactivity: | Human |
| Alternative Names: | BD-2, SAP1, DEFB2, DEFB4, HBD-2, DEFB-2, DEFB102 |
| RECOMBINANT HUMAN DEFENSIN BETA 2 Defensin beta-2 (BD-2), is a member of the beta defensin family, secreted at epithelial surfaces of the skin and respiratory tract and by some leukocytes. BD-2 is induced by bacterial products and cytokines during inflammation and functions as part of the innate immune system, having a wide ranging antimicrobial activity. BD-2 also functions as a chemoattractant to immature dendritic cells and memory T cells and acts as a ligand for TLR4, upregulating co-stimulatory molecules and inducing dendritic cell maturation. |
| Concentration: | 0.1 mg/ml |
| Molecular Weight: | 4.3 kDa (41 amino acid sequence/residues) |
| NCBI: | 1673 |
| Purity: | >98% by SDS PAGE and HPLC analysis. |
| Form: | Lyophilized |
| Sequence: | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
Product Guarantee and Expert Support
