Anti-CHGA Antibody , IgG1, Clone: [CL0166], Unconjugated, Mouse, Monoclonal

Artikelnummer: ATA-AMAB90525
Artikelname: Anti-CHGA Antibody , IgG1, Clone: [CL0166], Unconjugated, Mouse, Monoclonal
Artikelnummer: ATA-AMAB90525
Hersteller Artikelnummer: AMAb90525
Alternativnummer: ATA-AMAB90525-100,ATA-AMAB90525-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
chromogranin A (parathyroid secretory protein 1)
Anti-CHGA
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0166]
Isotyp: IgG1
NCBI: 1113
UniProt: P10645
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CHGA
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml
Immunohistochemical staining of human pancreas shows strong positivity in endocrine islets of Langerhans.
Immunohistochemical staining of human colon shows strong reactivity in a subset of enteroendocrine cells.
Immunohistochemical staining of human duodenum shows strong positivity in a subset of enteroendocrine cells.
Lane 1: Marker [kDa]
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: CHGA Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400511)
AMAb90525
AMAb90525
AMAb90525