Anti-CHGA

Catalog Number: ATA-AMAB90525
Article Name: Anti-CHGA
Biozol Catalog Number: ATA-AMAB90525
Supplier Catalog Number: AMAb90525
Alternative Catalog Number: ATA-AMAB90525-100,ATA-AMAB90525-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
chromogranin A (parathyroid secretory protein 1)

Anti-CHGA

Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL0166]
Isotype: IgG1
NCBI: 1113
UniProt: P10645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CHGA
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml
Immunohistochemical staining of human pancreas shows strong positivity in endocrine islets of Langerhans.
Immunohistochemical staining of human colon shows strong reactivity in a subset of enteroendocrine cells.
Immunohistochemical staining of human duodenum shows strong positivity in a subset of enteroendocrine cells.
Lane 1: Marker [kDa]
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: CHGA Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400511)
AMAb90525-100ul
AMAb90525-100ul
AMAb90525-100ul