Anti-NES
Artikelnummer:
ATA-AMAB90556
- Bilder (8)
| Artikelname: | Anti-NES |
| Artikelnummer: | ATA-AMAB90556 |
| Hersteller Artikelnummer: | AMAb90556 |
| Alternativnummer: | ATA-AMAB90556-100,ATA-AMAB90556-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ21841 |
| nestin |
| Anti-NES |
| Klonalität: | Monoclonal |
| Konzentration: | 0.1 |
| Klon-Bezeichnung: | [CL0197] |
| Isotyp: | IgG1 |
| NCBI: | 10763 |
| UniProt: | P48681 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NES |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the endothelial cells. |
|
|
Immunohistochemical staining of human kidney shows strong positivity in renal glomeruli. |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NES antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line U-251 MG |
|
|
AMAb90556-100ul |
|
|
|
|
|
AMAb90556-100ul |
|
|
AMAb90556-100ul |
Produktgarantie und fachkundiger Support
