Anti-NES
Catalog Number:
ATA-AMAB90556
- Images (8)
| Article Name: | Anti-NES |
| Biozol Catalog Number: | ATA-AMAB90556 |
| Supplier Catalog Number: | AMAb90556 |
| Alternative Catalog Number: | ATA-AMAB90556-100,ATA-AMAB90556-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ21841 |
| nestin |
| Anti-NES |
| Clonality: | Monoclonal |
| Concentration: | 0.1 |
| Clone Designation: | [CL0197] |
| Isotype: | IgG1 |
| NCBI: | 10763 |
| UniProt: | P48681 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NES |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the endothelial cells. |
|
|
Immunohistochemical staining of human kidney shows strong positivity in renal glomeruli. |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NES antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line U-251 MG |
|
|
AMAb90556-100ul |
|
|
|
|
|
AMAb90556-100ul |
|
|
AMAb90556-100ul |
Product Guarantee and Expert Support
