Anti-RNASE7
Artikelnummer:
ATA-AMAB90582
- Bilder (8)
| Artikelname: | Anti-RNASE7 |
| Artikelnummer: | ATA-AMAB90582 |
| Hersteller Artikelnummer: | AMAb90582 |
| Alternativnummer: | ATA-AMAB90582-100,ATA-AMAB90582-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RNASE7 |
| ribonuclease, RNase A family, 7 |
| Anti-RNASE7 |
| Klonalität: | Monoclonal |
| Konzentration: | 0.5 |
| Klon-Bezeichnung: | [CL0223] |
| Isotyp: | IgG1 |
| NCBI: | 84659 |
| UniProt: | Q9H1E1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RNASE7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human skin shows strong immunoreactivity in the outer layer of keratinized squamous epithelium. |
|
|
Immunohistochemical staining of human tonsil shows strong positivity in the outer layer of non-keratinized squamous epithelium. |
|
|
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate)] Lane 3: RNASE7 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410028) |
|
|
AMAb90582-100ul |
|
|
|
|
|
AMAb90582-100ul |
|
|
AMAb90582-100ul |
Produktgarantie und fachkundiger Support
