Anti-RNASE7
Catalog Number:
ATA-AMAB90582
- Images (8)
| Article Name: | Anti-RNASE7 |
| Biozol Catalog Number: | ATA-AMAB90582 |
| Supplier Catalog Number: | AMAb90582 |
| Alternative Catalog Number: | ATA-AMAB90582-100,ATA-AMAB90582-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RNASE7 |
| ribonuclease, RNase A family, 7 |
| Anti-RNASE7 |
| Clonality: | Monoclonal |
| Concentration: | 0.5 |
| Clone Designation: | [CL0223] |
| Isotype: | IgG1 |
| NCBI: | 84659 |
| UniProt: | Q9H1E1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RNASE7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human skin shows strong immunoreactivity in the outer layer of keratinized squamous epithelium. |
|
|
Immunohistochemical staining of human tonsil shows strong positivity in the outer layer of non-keratinized squamous epithelium. |
|
|
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate)] Lane 3: RNASE7 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410028) |
|
|
AMAb90582-100ul |
|
|
|
|
|
AMAb90582-100ul |
|
|
AMAb90582-100ul |
Product Guarantee and Expert Support
