Anti-TSPAN7
Artikelnummer:
ATA-AMAB90621
- Bilder (8)
| Artikelname: | Anti-TSPAN7 |
| Artikelnummer: | ATA-AMAB90621 |
| Hersteller Artikelnummer: | AMAb90621 |
| Alternativnummer: | ATA-AMAB90621-100,ATA-AMAB90621-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2 |
| tetraspanin 7 |
| Anti-TSPAN7 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL0262] |
| Isotyp: | IgG1 |
| NCBI: | 7102 |
| UniProt: | P41732 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TSPAN7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the neuropil. |
|
|
Immunohistochemical staining of human cerebellum shows strong positivity in the molecular layer and moderate staining in the granular cell layer. |
|
|
Immunohistochemical staining of human pancreas shows strong positivity in the islets of Langerhans. |
|
|
Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: TSPAN7 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401460) |
|
|
AMAb90621-100ul |
|
|
|
|
|
AMAb90621-100ul |
|
|
AMAb90621-100ul |
Produktgarantie und fachkundiger Support
