Anti-TSPAN7
Catalog Number:
ATA-AMAB90621
- Images (8)
| Article Name: | Anti-TSPAN7 |
| Biozol Catalog Number: | ATA-AMAB90621 |
| Supplier Catalog Number: | AMAb90621 |
| Alternative Catalog Number: | ATA-AMAB90621-100,ATA-AMAB90621-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | A15, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2 |
| tetraspanin 7 |
| Anti-TSPAN7 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0262] |
| Isotype: | IgG1 |
| NCBI: | 7102 |
| UniProt: | P41732 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TSPAN7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the neuropil. |
|
|
Immunohistochemical staining of human cerebellum shows strong positivity in the molecular layer and moderate staining in the granular cell layer. |
|
|
Immunohistochemical staining of human pancreas shows strong positivity in the islets of Langerhans. |
|
|
Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: TSPAN7 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401460) |
|
|
AMAb90621-100ul |
|
|
|
|
|
AMAb90621-100ul |
|
|
AMAb90621-100ul |
Product Guarantee and Expert Support
