Anti-SCGN
Artikelnummer:
ATA-AMAB90630
- Bilder (8)
| Artikelname: | Anti-SCGN |
| Artikelnummer: | ATA-AMAB90630 |
| Hersteller Artikelnummer: | AMAb90630 |
| Alternativnummer: | ATA-AMAB90630-100,ATA-AMAB90630-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CALBL, DJ501N12.8, SECRET, SEGN |
| secretagogin, EF-hand calcium binding protein |
| Anti-SCGN |
| Klonalität: | Monoclonal |
| Konzentration: | 0.1 |
| Klon-Bezeichnung: | [CL0271] |
| Isotyp: | IgG1 |
| NCBI: | 10590 |
| UniProt: | O76038 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SCGN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear immunoreactivity in the islets of Langerhans. |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in the molecular layer. |
|
|
Immunohistochemical staining of human duodenum shows strong immunoreactivity in the neuroendocrine cells, as well as in the local ganglionic cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Human brain tissue lysate |
|
|
AMAb90630-100ul |
|
|
|
|
|
AMAb90630-100ul |
|
|
AMAb90630-100ul |
Produktgarantie und fachkundiger Support
