Anti-SCGN
Catalog Number:
ATA-AMAB90630
- Images (8)
| Article Name: | Anti-SCGN |
| Biozol Catalog Number: | ATA-AMAB90630 |
| Supplier Catalog Number: | AMAb90630 |
| Alternative Catalog Number: | ATA-AMAB90630-100,ATA-AMAB90630-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CALBL, DJ501N12.8, SECRET, SEGN |
| secretagogin, EF-hand calcium binding protein |
| Anti-SCGN |
| Clonality: | Monoclonal |
| Concentration: | 0.1 |
| Clone Designation: | [CL0271] |
| Isotype: | IgG1 |
| NCBI: | 10590 |
| UniProt: | O76038 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SCGN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear immunoreactivity in the islets of Langerhans. |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in the molecular layer. |
|
|
Immunohistochemical staining of human duodenum shows strong immunoreactivity in the neuroendocrine cells, as well as in the local ganglionic cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Human brain tissue lysate |
|
|
AMAb90630-100ul |
|
|
|
|
|
AMAb90630-100ul |
|
|
AMAb90630-100ul |
Product Guarantee and Expert Support
