Anti-USP46
Artikelnummer:
ATA-AMAB90722
- Bilder (6)
| Artikelname: | Anti-USP46 |
| Artikelnummer: | ATA-AMAB90722 |
| Hersteller Artikelnummer: | AMAb90722 |
| Alternativnummer: | ATA-AMAB90722-100,ATA-AMAB90722-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ12552 |
| ubiquitin specific peptidase 46 |
| Anti-USP46 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL0363] |
| Isotyp: | IgG2b |
| NCBI: | 64854 |
| UniProt: | P62068 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | USP46 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, WB: 1 µg/ml |
|
|
Immunofluorescence staining of U-2 OS cells using the anti-USP46 monoclonal antibody, showing specific staining in nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-USP46 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line U-251 MG |
|
|
AMAb90722-100ul |
|
|
AMAb90722-100ul |
|
|
AMAb90722-100ul |
Produktgarantie und fachkundiger Support
