Anti-USP46
Catalog Number:
ATA-AMAB90722
- Images (6)
| Article Name: | Anti-USP46 |
| Biozol Catalog Number: | ATA-AMAB90722 |
| Supplier Catalog Number: | AMAb90722 |
| Alternative Catalog Number: | ATA-AMAB90722-100,ATA-AMAB90722-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ12552 |
| ubiquitin specific peptidase 46 |
| Anti-USP46 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0363] |
| Isotype: | IgG2b |
| NCBI: | 64854 |
| UniProt: | P62068 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | USP46 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, WB: 1 µg/ml |
|
|
Immunofluorescence staining of U-2 OS cells using the anti-USP46 monoclonal antibody, showing specific staining in nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-USP46 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line U-251 MG |
|
|
AMAb90722-100ul |
|
|
AMAb90722-100ul |
|
|
AMAb90722-100ul |
Product Guarantee and Expert Support
