Anti-APOA4, IgG1, Clone: [CL0467], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90768
Artikelname: Anti-APOA4, IgG1, Clone: [CL0467], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90768
Hersteller Artikelnummer: AMAb90768
Alternativnummer: ATA-AMAB90768-100,ATA-AMAB90768-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: APOA4
apolipoprotein A-IV
Anti-APOA4
Klonalität: Monoclonal
Konzentration: 0.1
Klon-Bezeichnung: [CL0467]
Isotyp: IgG1
NCBI: 337
UniProt: P06727
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: APOA4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemical staining of human colon shows strong strong immunoreactivity in plasma in a large blood vessel.
Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in a subset of renal tubules.
Immunohistochemical staining of human cerebral cortex shows strong positivity in blood vessels.
Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human plasma
AMAb90768
AMAb90768
AMAb90768