Anti-APOA4 Antibody , IgG1, Clone: [CL0467], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB90768
Article Name: Anti-APOA4 Antibody , IgG1, Clone: [CL0467], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB90768
Supplier Catalog Number: AMAb90768
Alternative Catalog Number: ATA-AMAB90768-100,ATA-AMAB90768-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: APOA4
apolipoprotein A-IV
Anti-APOA4
Clonality: Monoclonal
Concentration: 0.1
Clone Designation: [CL0467]
Isotype: IgG1
NCBI: 337
UniProt: P06727
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: APOA4
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemical staining of human colon shows strong strong immunoreactivity in plasma in a large blood vessel.
Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in a subset of renal tubules.
Immunohistochemical staining of human cerebral cortex shows strong positivity in blood vessels.
Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human plasma
AMAb90768
AMAb90768
AMAb90768