Anti-APOA4 Antibody , IgG1, Clone: [CL0467], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-APOA4 Antibody , IgG1, Clone: [CL0467], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90768
• Supplier Catalog Number: AMAb90768
• Alternative Catalog Number: ATA-AMAB90768-100,ATA-AMAB90768-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: APOA4

Product Description

apolipoprotein A-IV

Additional Information

Anti-APOA4

Product Properties

• Clonality: Monoclonal
• Concentration: 0.1
• Clone Designation: [CL0467]
• Isotype: IgG1
• NCBI: 337
• UniProt: P06727
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: APOA4
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:2500 - 1:5000, WB: 1 µg/ml

Images

Immunohistochemical staining of human colon shows strong strong immunoreactivity in plasma in a large blood vessel.

Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in a subset of renal tubules.

Immunohistochemical staining of human cerebral cortex shows strong positivity in blood vessels.

Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).

Lane 1: Marker [kDa]
Lane 2: Human plasma

AMAb90768

AMAb90768

AMAb90768