Anti-NECAB1

Artikelnummer: ATA-AMAB90800
Artikelname: Anti-NECAB1
Artikelnummer: ATA-AMAB90800
Hersteller Artikelnummer: AMAb90800
Alternativnummer: ATA-AMAB90800-100,ATA-AMAB90800-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EFCBP1
N-terminal EF-hand calcium binding protein 1
Anti-NECAB1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0575]
Isotyp: IgG2a
NCBI: 64168
UniProt: Q8N987
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NECAB1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human cerebral cortex shows immunoreactivity in a subset of neuronal cells.
Immunohistochemical staining of human kidney shows positivity in renal glomeruli.
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human cerebral cortex lysate
AMAb90800-100ul
AMAb90800-100ul
AMAb90800-100ul