Anti-NECAB1

Catalog Number: ATA-AMAB90800
Article Name: Anti-NECAB1
Biozol Catalog Number: ATA-AMAB90800
Supplier Catalog Number: AMAb90800
Alternative Catalog Number: ATA-AMAB90800-100,ATA-AMAB90800-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: EFCBP1
N-terminal EF-hand calcium binding protein 1
Anti-NECAB1
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL0575]
Isotype: IgG2a
NCBI: 64168
UniProt: Q8N987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NECAB1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human cerebral cortex shows immunoreactivity in a subset of neuronal cells.
Immunohistochemical staining of human kidney shows positivity in renal glomeruli.
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human cerebral cortex lysate
AMAb90800-100ul
AMAb90800-100ul
AMAb90800-100ul