Anti-MKI67

Artikelnummer: ATA-AMAB90870
Artikelname: Anti-MKI67
Artikelnummer: ATA-AMAB90870
Hersteller Artikelnummer: AMAb90870
Alternativnummer: ATA-AMAB90870-100,ATA-AMAB90870-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
antigen identified by monoclonal antibody Ki-67
Anti-MKI67
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1234]
Isotyp: IgG1
NCBI: 4288
UniProt: P46013
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: DGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQSGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MKI67
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500
Immunohistochemical staining of lymph node in human colon shows strong nuclear and nucleolar immunoreactivity in the reaction centrum cells.
Immunohistochemical staining of human colon shows nuclear postivity in a subset of glandular cells.
Immunohistochemical staining of human uterus shows nuclear immunoreactivity in a subset of glandular cells.
Immunohistochemical staining of human small intestine shows nuclear positivity in a subset of glandular cells.
Immunohistochemical staining of stomach cancer shows nuclear and nucleolar immunoreactivity in tumor cells.
Immunohistochemical staining of human colorectal cancer shows positivity in a subset of tumor cells.
AMAb90870-100ul
AMAb90870-100ul
AMAb90870-100ul