Anti-MKI67 Antibody , IgG1, Clone: [CL1234], Unconjugated, Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90870
- Bilder (10)
| Artikelname: | Anti-MKI67 Antibody , IgG1, Clone: [CL1234], Unconjugated, Mouse, Monoclonal |
| Artikelnummer: | ATA-AMAB90870 |
| Hersteller Artikelnummer: | AMAb90870 |
| Alternativnummer: | ATA-AMAB90870-100,ATA-AMAB90870-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Pan-Cancer |
| antigen identified by monoclonal antibody Ki-67 |
| Anti-MKI67 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL1234] |
| Isotyp: | IgG1 |
| NCBI: | 4288 |
| UniProt: | P46013 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | DGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQSGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MKI67 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of lymph node in human colon shows strong nuclear and nucleolar immunoreactivity in the reaction centrum cells. |
|
|
Immunohistochemical staining of human colon shows nuclear postivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human uterus shows nuclear immunoreactivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human small intestine shows nuclear positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of stomach cancer shows nuclear and nucleolar immunoreactivity in tumor cells. |
|
|
Immunohistochemical staining of human colorectal cancer shows positivity in a subset of tumor cells. |
|
|
AMAb90870 |
|
|
|
|
|
AMAb90870 |
|
|
AMAb90870 |
Produktgarantie und fachkundiger Support
