Anti-MKI67

Product Overview

• Article Name: Anti-MKI67
• Biozol Catalog Number: ATA-AMAB90870
• Supplier Catalog Number: AMAb90870
• Alternative Catalog Number: ATA-AMAB90870-100,ATA-AMAB90870-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Sonstiges
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: Pan-Cancer

Product Description

antigen identified by monoclonal antibody Ki-67

Additional Information

Anti-MKI67

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL1234]
• Isotype: IgG1
• NCBI: 4288
• UniProt: P46013
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: DGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQSGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MKI67
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500

Images

Immunohistochemical staining of lymph node in human colon shows strong nuclear and nucleolar immunoreactivity in the reaction centrum cells.

Immunohistochemical staining of human colon shows nuclear postivity in a subset of glandular cells.

Immunohistochemical staining of human uterus shows nuclear immunoreactivity in a subset of glandular cells.

Immunohistochemical staining of human small intestine shows nuclear positivity in a subset of glandular cells.

Immunohistochemical staining of stomach cancer shows nuclear and nucleolar immunoreactivity in tumor cells.

Immunohistochemical staining of human colorectal cancer shows positivity in a subset of tumor cells.

AMAb90870-100ul

AMAb90870-100ul

AMAb90870-100ul