Anti-ATF3 Antibody , IgG1, Clone: [CL1685], Unconjugated, Mouse, Monoclonal

Artikelnummer: ATA-AMAB90909
Artikelname: Anti-ATF3 Antibody , IgG1, Clone: [CL1685], Unconjugated, Mouse, Monoclonal
Artikelnummer: ATA-AMAB90909
Hersteller Artikelnummer: AMAb90909
Alternativnummer: ATA-AMAB90909-100,ATA-AMAB90909-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ATF3
activating transcription factor 3
Anti-ATF3
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1685]
Isotyp: IgG1
NCBI: 467
UniProt: P18847
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ATF3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and tonsil tissues using AMAb90909 antibody. Corresponding ATF3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemical staining of human stomach cancer shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
AMAb90909
AMAb90909
AMAb90909