Anti-ATF3

Catalog Number: ATA-AMAB90909
Article Name: Anti-ATF3
Biozol Catalog Number: ATA-AMAB90909
Supplier Catalog Number: AMAb90909
Alternative Catalog Number: ATA-AMAB90909-100,ATA-AMAB90909-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ATF3
activating transcription factor 3
Anti-ATF3
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL1685]
Isotype: IgG1
NCBI: 467
UniProt: P18847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ATF3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and tonsil tissues using AMAb90909 antibody. Corresponding ATF3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemical staining of human stomach cancer shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
AMAb90909-100ul
AMAb90909-100ul
AMAb90909-100ul